General Information

  • ID:  hor007183
  • Uniprot ID:  Q63073
  • Protein name:  Protein BTG1
  • Gene name:  CCK
  • Organism:  Rattus norvegicus
  • Family:  BTG family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat)
  • GO MF:  GO:0005737 cytoplasm; GO:0005634 nucleus
  • GO BP:  GO:0019899 enzyme binding
  • GO CC:  GO:0007286 spermatid development; GO:0043434 response to peptide hormone; GO:0006979 response to oxidative stress; GO:0045663 positive regulation of myoblast differentiation; GO:2000271 positive regulation of fibroblast apoptotic process; GO:0045603 positive regulation of endothelial cell differentiation; GO:0045766 positive regulation of angiogenesis; GO:0045930 negative regulation of mitotic cell cycle; GO:0007283 spermatogenesis; GO:0008283 cell population proliferation; GO:0008285 negative regulation of cell population proliferation

Sequence Information

  • Sequence:  HPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSSQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
  • Length:  170
  • Propeptide:  MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSSQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
  • Signal peptide:  MMKLIQLCILFWCWRAICCH
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA